Lineage for d5c8wb_ (5c8w B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082241Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2082242Protein automated matches [226927] (14 species)
    not a true protein
  7. 2082262Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)
  8. 2082271Domain d5c8wb_: 5c8w B: [312713]
    automated match to d4offa_
    complexed with mla, na, pcg

Details for d5c8wb_

PDB Entry: 5c8w (more details), 1.8 Å

PDB Description: pkg ii's amino terminal cyclic nucleotide binding domain (cnb-a) in a complex with cgmp
PDB Compounds: (B:) cGMP-dependent protein kinase 2

SCOPe Domain Sequences for d5c8wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c8wb_ b.82.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arvrkdssekklitdalnknqflkrldpqqikdmvecmygrnyqqgsyiikqgepgnhif
vlaegrlevfqgekllssipmwttfgelailynctrtasvkaitnvktwaldrevfqnim
r

SCOPe Domain Coordinates for d5c8wb_:

Click to download the PDB-style file with coordinates for d5c8wb_.
(The format of our PDB-style files is described here.)

Timeline for d5c8wb_: