Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries) |
Domain d5b0bb_: 5b0b B: [312687] automated match to d1q4ra_ complexed with act; mutant |
PDB Entry: 5b0b (more details), 2.19 Å
SCOPe Domain Sequences for d5b0bb_:
Sequence, based on SEQRES records: (download)
>d5b0bb_ d.58.4.0 (B:) automated matches {Cannabis sativa [TaxId: 3483]} avkhlfvlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev tfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk
>d5b0bb_ d.58.4.0 (B:) automated matches {Cannabis sativa [TaxId: 3483]} avkhlfvlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdgythivevtfesveti qdyiihpahvgfgdvyrsfwekllifdytprk
Timeline for d5b0bb_: