SCOPe 2.06: Domain d5b08b1: 5b08 B:1-101

Lineage for d5b08b1 (5b08 B:1-101)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries)

8. Domain d5b08b1: 5b08 B:1-101 [312665]
   Other proteins in same PDB: d5b08b2
   automated match to d1q4ra_

Details for d5b08b1

PDB Entry: 5b08, 1.33 Å

PDB Description: polyketide cyclase oac from cannabis sativa

PDB Compounds: (B:) Olivetolic acid cyclase

SCOPe Domain Sequences for d5b08b1:

Sequence; same for both SEQRES and ATOM records:

>d5b08b1 d.58.4.0 (B:1-101) automated matches {Cannabis sativa [TaxId: 3483]}
mavkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythive
vtfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

Timeline for d5b08b1:

• d5b08b1 is new in SCOPe 2.06-stable
  
• d5b08b1 appears in SCOPe 2.07
  
• d5b08b1 appears in the current release, SCOPe 2.08