Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (27 species) not a true protein |
Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries) |
Domain d5b08b1: 5b08 B:1-101 [312665] Other proteins in same PDB: d5b08b2 automated match to d1q4ra_ |
PDB Entry: 5b08 (more details), 1.33 Å
SCOPe Domain Sequences for d5b08b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b08b1 d.58.4.0 (B:1-101) automated matches {Cannabis sativa [TaxId: 3483]} mavkhlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythive vtfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk
Timeline for d5b08b1: