Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (32 species) not a true protein |
Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries) |
Domain d5c1ob2: 5c1o B:97-306 [312663] Other proteins in same PDB: d5c1oa1, d5c1ob1, d5c1oc1, d5c1od1 automated match to d1iova2 complexed with anp, mg, na |
PDB Entry: 5c1o (more details), 2.5 Å
SCOPe Domain Sequences for d5c1ob2:
Sequence, based on SEQRES records: (download)
>d5c1ob2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg mtshslvpmaarqyglsfsqlvarilmlad
>d5c1ob2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 632]} klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshesvgmskvd haselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqpptqyfcpsglsde seqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqygl sfsqlvarilmlad
Timeline for d5c1ob2: