Lineage for d5b1cc_ (5b1c C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766220Species Dengue virus 4 dominica/814669/1981 [TaxId:408871] [312577] (1 PDB entry)
  8. 2766223Domain d5b1cc_: 5b1c C: [312633]
    Other proteins in same PDB: d5b1ca2
    automated match to d2h0pa_
    complexed with so4; mutant

Details for d5b1cc_

PDB Entry: 5b1c (more details), 2 Å

PDB Description: crystal structure of den4 ed3 mutant with l387i
PDB Compounds: (C:) Envelope protein E

SCOPe Domain Sequences for d5b1cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1cc_ b.1.18.0 (C:) automated matches {Dengue virus 4 dominica/814669/1981 [TaxId: 408871]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltihwfrkg

SCOPe Domain Coordinates for d5b1cc_:

Click to download the PDB-style file with coordinates for d5b1cc_.
(The format of our PDB-style files is described here.)

Timeline for d5b1cc_: