Lineage for d5bpha1 (5bph A:1-96)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2121012Species Yersinia pestis [TaxId:632] [280582] (5 PDB entries)
  8. 2121013Domain d5bpha1: 5bph A:1-96 [312602]
    Other proteins in same PDB: d5bpha2, d5bphb2, d5bphc2, d5bphd2
    automated match to d1iowa1
    complexed with act, amp, gol, na

Details for d5bpha1

PDB Entry: 5bph (more details), 1.7 Å

PDB Description: crystal structure of amp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5bpha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bpha1 c.30.1.0 (A:1-96) automated matches {Yersinia pestis [TaxId: 632]}
maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
alhgrggedgtlqgvleflqlpytgsgvmasaltmd

SCOPe Domain Coordinates for d5bpha1:

Click to download the PDB-style file with coordinates for d5bpha1.
(The format of our PDB-style files is described here.)

Timeline for d5bpha1: