Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein automated matches [190370] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries) |
Domain d5b25a_: 5b25 A: [312597] automated match to d1taza_ complexed with 4qj, gol, mg, so4, zn |
PDB Entry: 5b25 (more details), 1.9 Å
SCOPe Domain Sequences for d5b25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b25a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla gdpnpdvvsfrstwvkriqenkqkwkeraasgitn
Timeline for d5b25a_: