Lineage for d5b25a_ (5b25 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737088Protein automated matches [190370] (2 species)
    not a true protein
  7. 2737094Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2737109Domain d5b25a_: 5b25 A: [312597]
    automated match to d1taza_
    complexed with 4qj, gol, mg, so4, zn

Details for d5b25a_

PDB Entry: 5b25 (more details), 1.9 Å

PDB Description: crystal structure of human pde1b with inhibitor 3
PDB Compounds: (A:) Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B

SCOPe Domain Sequences for d5b25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b25a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
gdpnpdvvsfrstwvkriqenkqkwkeraasgitn

SCOPe Domain Coordinates for d5b25a_:

Click to download the PDB-style file with coordinates for d5b25a_.
(The format of our PDB-style files is described here.)

Timeline for d5b25a_: