SCOPe 2.08: Domain d5arlc1: 5arl C:1-119

Lineage for d5arlc1 (5arl C:1-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [312520] (3 PDB entries)

8. Domain d5arlc1: 5arl C:1-119 [312586]
   Other proteins in same PDB: d5arla2, d5arlb2, d5arlc2, d5arld2
   automated match to d2rnfa_
   protein/RNA complex; complexed with dcm; mutant

Details for d5arlc1

PDB Entry: 5arl, 2.61 Å

PDB Description: crystal structure of porcine rnase 4 d80a mutant in complex with dcmp

PDB Compounds: (C:) ribonuclease 4

SCOPe Domain Sequences for d5arlc1:

Sequence; same for both SEQRES and ATOM records:

>d5arlc1 d.5.1.1 (C:1-119) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
niqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk

Timeline for d5arlc1:

• d5arlc1 first appeared in SCOPe 2.06
  
• d5arlc1 appears in SCOPe 2.07