SCOPe 2.08: Domain d5b0ab_: 5b0a B:

Lineage for d5b0ab_ (5b0a B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries)

8. Domain d5b0ab_: 5b0a B: [312566]
   automated match to d1q4ra_
   mutant

Details for d5b0ab_

PDB Entry: 5b0a, 2.1 Å

PDB Description: polyketide cyclase oac from cannabis sativa, h5q mutant

PDB Compounds: (B:) Olivetolic acid cyclase

SCOPe Domain Sequences for d5b0ab_:

Sequence, based on SEQRES records:

>d5b0ab_ d.58.4.0 (B:) automated matches {Cannabis sativa [TaxId: 3483]}
avkqlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

Sequence, based on observed residues (ATOM records):

>d5b0ab_ d.58.4.0 (B:) automated matches {Cannabis sativa [TaxId: 3483]}
avkqlivlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfiqdyiihpahvgfgdvyrsfwekllifdytprk

Timeline for d5b0ab_:

• d5b0ab_ first appeared in SCOPe 2.06
  
• d5b0ab_ appears in SCOPe 2.07