SCOP 1.65: Domain d6reqc2: 6req C:561-728

Lineage for d6reqc2 (6req C:561-728)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family)

5. Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (4 proteins)

6. Protein Methylmalonyl-CoA mutase alpha subunit, C-terminal domain [88717] (1 species)
   active subunit; binds B12

7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88718] (8 PDB entries)

8. Domain d6reqc2: 6req C:561-728 [31253]
   Other proteins in same PDB: d6reqa1, d6reqb1, d6reqb2, d6reqc1, d6reqd1, d6reqd2
   complexed with 3cp, b12, gol; mutant

Details for d6reqc2

PDB Entry: 6req, 2.2 Å

PDB Description: methylmalonyl-coa mutase, 3-carboxypropyl-coa inhibitor complex

SCOP Domain Sequences for d6reqc2:

Sequence; same for both SEQRES and ATOM records:

>d6reqc2 c.23.6.1 (C:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii}
aqirtisgvyskevkntpeveearelveefeqaegrrprillakmgqdghdrgqkviata
yadlgfdvdvgplfqtpeetarqaveadvhvvgvsslagghltlvpalrkeldklgrpdi
litvggvipeqdfdelrkdgaveiytpgtvipesaislvkklraslda

Timeline for d6reqc2:

• d6reqc2 first appeared (with stable ids) in SCOP 1.55
  
• d6reqc2 appears in SCOP 1.63
  
• d6reqc2 appears in SCOP 1.67
  
• d6reqc2 appears in the current release, SCOPe 2.08