Lineage for d5a1ta2 (5a1t A:155-333)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557585Species Trichomonas vaginalis [TaxId:5722] [276012] (5 PDB entries)
  8. 2557592Domain d5a1ta2: 5a1t A:155-333 [312492]
    Other proteins in same PDB: d5a1ta1, d5a1ta3, d5a1tb1
    automated match to d4uula2
    complexed with nai, oxm

Details for d5a1ta2

PDB Entry: 5a1t (more details), 1.97 Å

PDB Description: trichomonas vaginalis lactate dehydrogenase in complex with nadh and oxamate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d5a1ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a1ta2 d.162.1.0 (A:155-333) automated matches {Trichomonas vaginalis [TaxId: 5722]}
smldqnrayyevasklgvdvkdvhdiivwgnhgesmvadltqatftkegktqkvvdvldh
dyvfdtffkkighrawdilehrgftsaasptkaaiqhmkawlfgtapgevlsmgipvpeg
npygikpgvvfsfpcnvdkegkihvvegfkvndwlrekldftekdlfhekeialnhlaq

SCOPe Domain Coordinates for d5a1ta2:

Click to download the PDB-style file with coordinates for d5a1ta2.
(The format of our PDB-style files is described here.)

Timeline for d5a1ta2: