Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries) |
Domain d5a8ba_: 5a8b A: [312468] Other proteins in same PDB: d5a8bc2 automated match to d5dklb_ complexed with cl, fmn, gol |
PDB Entry: 5a8b (more details), 2.79 Å
SCOPe Domain Sequences for d5a8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a8ba_ d.110.3.0 (A:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]} fsfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgpetdpk averirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckvsdqya atvtkqqeeeee
Timeline for d5a8ba_:
View in 3D Domains from other chains: (mouse over for more information) d5a8bb_, d5a8bc1, d5a8bc2, d5a8bd_ |