Lineage for d4ynyd2 (4yny D:130-229)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2358794Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (14 PDB entries)
  8. 2358800Domain d4ynyd2: 4yny D:130-229 [312408]
    automated match to d2fb4l2

Details for d4ynyd2

PDB Entry: 4yny (more details), 1.58 Å

PDB Description: crystal structure of monoclonal anti-human podoplanin antibody nz-1
PDB Compounds: (D:) Light chain of antigen binding fragment, Fab

SCOPe Domain Sequences for d4ynyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ynyd2 b.1.1.0 (D:130-229) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpkstptltvfppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkq
gnkyiassflrltaeqwrsrnsftcqvthegntvekslsp

SCOPe Domain Coordinates for d4ynyd2:

Click to download the PDB-style file with coordinates for d4ynyd2.
(The format of our PDB-style files is described here.)

Timeline for d4ynyd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ynyd1