Lineage for d4zohb2 (4zoh B:171-277)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204289Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2204452Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2204514Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2204515Protein automated matches [232090] (4 species)
    not a true protein
  7. 2204553Species Sulfolobus tokodaii [TaxId:273063] [312397] (1 PDB entry)
  8. 2204554Domain d4zohb2: 4zoh B:171-277 [312398]
    Other proteins in same PDB: d4zohb1, d4zohc1, d4zohc2
    automated match to d1ffuc1
    complexed with 1pe, acy, fad, fes, mcn, mo, peg, pg4

Details for d4zohb2

PDB Entry: 4zoh (more details), 2.2 Å

PDB Description: crystal structure of glyceraldehyde oxidoreductase
PDB Compounds: (B:) Putative oxidoreductase FAD-binding subunit

SCOPe Domain Sequences for d4zohb2:

Sequence, based on SEQRES records: (download)

>d4zohb2 d.87.2.0 (B:171-277) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
gykfsyqklerragdfaivgvalllklsgdviedvrigltavnnvavrakgaeeellgkr
lndeiiekaatramesanptsdlrgsaeykkkmvkvltkraiitalk

Sequence, based on observed residues (ATOM records): (download)

>d4zohb2 d.87.2.0 (B:171-277) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
gykfsyqklerragdfaivgvalllklsgdviedvrigltavnnvavrakgaeeellgkr
lndeiiekaatramesanptsgsaeykkkmvkvltkraiitalk

SCOPe Domain Coordinates for d4zohb2:

Click to download the PDB-style file with coordinates for d4zohb2.
(The format of our PDB-style files is described here.)

Timeline for d4zohb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zohb1