Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) automatically mapped to Pfam PF00591 |
Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
Protein automated matches [254642] (4 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries) |
Domain d4yyya2: 4yyy A:71-335 [312281] Other proteins in same PDB: d4yyya1, d4yyya3, d4yyyb1, d4yyyb3 automated match to d4x46b2 complexed with cit, pge, uri |
PDB Entry: 4yyy (more details), 2.43 Å
SCOPe Domain Sequences for d4yyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yyya2 c.27.1.1 (A:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]} dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa evfgrmvaaqkgpsdfvenydkylp
Timeline for d4yyya2: