Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries) |
Domain d4yy1d_: 4yy1 D: [312254] Other proteins in same PDB: d4yy1a_, d4yy1c_ automated match to d3s12b_ complexed with nag |
PDB Entry: 4yy1 (more details), 3.1 Å
SCOPe Domain Sequences for d4yy1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yy1d_ h.3.1.1 (D:) automated matches {Unidentified influenza virus [TaxId: 119212]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqk
Timeline for d4yy1d_: