Lineage for d4ynca_ (4ync A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828208Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2828209Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries)
  8. 2828223Domain d4ynca_: 4ync A: [312192]
    automated match to d1bwka_
    complexed with 4eg, cl, fmn
    has additional insertions and/or extensions that are not grouped together

Details for d4ynca_

PDB Entry: 4ync (more details), 1.5 Å

PDB Description: oye1 w116a complexed with (z)-methyl-3-cyano-3-phenylacrylate in a non productive binding mode
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d4ynca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ynca_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlavlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwd

SCOPe Domain Coordinates for d4ynca_:

Click to download the PDB-style file with coordinates for d4ynca_.
(The format of our PDB-style files is described here.)

Timeline for d4ynca_: