Lineage for d4yp9a1 (4yp9 A:24-364)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161659Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 2161660Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)
  8. 2161666Domain d4yp9a1: 4yp9 A:24-364 [312080]
    Other proteins in same PDB: d4yp9a2, d4yp9b2
    automated match to d1zhha_
    complexed with 4ex, ca, mg

Details for d4yp9a1

PDB Entry: 4yp9 (more details), 2.7 Å

PDB Description: crystal structure of luxp in complex with a formose derived ai-2 analogue
PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d4yp9a1:

Sequence, based on SEQRES records: (download)

>d4yp9a1 c.93.1.1 (A:24-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
vlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywv
rniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkf
vehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysv
lyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiya
cstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeai
kwdledkpvptvysgdfeivtkadsperiealkkrafrysd

Sequence, based on observed residues (ATOM records): (download)

>d4yp9a1 c.93.1.1 (A:24-364) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
vlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywv
rniasfekrlyklninyqlnqvftrpnaslslmealksksdyliftldttrhrkfvehvl
dstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyfse
gyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacstdv
algavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwdle
dkpvptvysgdfeivtkadsperiealkkrafrysd

SCOPe Domain Coordinates for d4yp9a1:

Click to download the PDB-style file with coordinates for d4yp9a1.
(The format of our PDB-style files is described here.)

Timeline for d4yp9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yp9a2