Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (3 families) |
Family d.45.1.0: automated matches [191583] (1 protein) not a true family |
Protein automated matches [191039] (4 species) not a true protein |
Species Agrobacterium fabrum [TaxId:176299] [312037] (2 PDB entries) |
Domain d4yjxd_: 4yjx D: [312068] automated match to d3gq1a_ complexed with nfa, so4 |
PDB Entry: 4yjx (more details), 2.55 Å
SCOPe Domain Sequences for d4yjxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yjxd_ d.45.1.0 (D:) automated matches {Agrobacterium fabrum [TaxId: 176299]} rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet kakeatdlgkeagfplmfttepe
Timeline for d4yjxd_: