Lineage for d4ykac_ (4yka C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2946591Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2946656Family d.45.1.0: automated matches [191583] (1 protein)
    not a true family
  6. 2946657Protein automated matches [191039] (4 species)
    not a true protein
  7. 2946658Species Agrobacterium fabrum [TaxId:176299] [312037] (2 PDB entries)
  8. 2946665Domain d4ykac_: 4yka C: [312066]
    automated match to d3gq1a_
    complexed with so4, tyc

Details for d4ykac_

PDB Entry: 4yka (more details), 2.8 Å

PDB Description: the structure of agrobacterium tumefaciens clps2 in complex with l- tyrosinamide
PDB Compounds: (C:) ATP-dependent Clp protease adapter protein ClpS 2

SCOPe Domain Sequences for d4ykac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ykac_ d.45.1.0 (C:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
kakeatdlgkeagfplmfttepee

SCOPe Domain Coordinates for d4ykac_:

Click to download the PDB-style file with coordinates for d4ykac_.
(The format of our PDB-style files is described here.)

Timeline for d4ykac_: