Lineage for d4yjxc_ (4yjx C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553479Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2553480Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2553545Family d.45.1.0: automated matches [191583] (1 protein)
    not a true family
  6. 2553546Protein automated matches [191039] (4 species)
    not a true protein
  7. 2553547Species Agrobacterium fabrum [TaxId:176299] [312037] (2 PDB entries)
  8. 2553550Domain d4yjxc_: 4yjx C: [312049]
    automated match to d3gq1a_
    complexed with nfa, so4

Details for d4yjxc_

PDB Entry: 4yjx (more details), 2.55 Å

PDB Description: the structure of agrobacterium tumefaciens clps2 bound to l- phenylalaninamide
PDB Compounds: (C:) ATP-dependent Clp protease adapter protein ClpS 2

SCOPe Domain Sequences for d4yjxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yjxc_ d.45.1.0 (C:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
kakeatdlgkeagfplmfttepee

SCOPe Domain Coordinates for d4yjxc_:

Click to download the PDB-style file with coordinates for d4yjxc_.
(The format of our PDB-style files is described here.)

Timeline for d4yjxc_: