Lineage for d4yjxa_ (4yjx A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190278Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2190279Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2190344Family d.45.1.0: automated matches [191583] (1 protein)
    not a true family
  6. 2190345Protein automated matches [191039] (3 species)
    not a true protein
  7. 2190346Species Agrobacterium fabrum [TaxId:176299] [312037] (2 PDB entries)
  8. 2190347Domain d4yjxa_: 4yjx A: [312038]
    automated match to d3gq1a_
    complexed with nfa, so4

Details for d4yjxa_

PDB Entry: 4yjx (more details), 2.55 Å

PDB Description: the structure of agrobacterium tumefaciens clps2 bound to l- phenylalaninamide
PDB Compounds: (A:) ATP-dependent Clp protease adapter protein ClpS 2

SCOPe Domain Sequences for d4yjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yjxa_ d.45.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
rpklykvmllnddytprefvtvvlkavfrmsedtgrrvmmtahrfgsavvvvcerdiaet
kakeatdlgkeagfplmfttepe

SCOPe Domain Coordinates for d4yjxa_:

Click to download the PDB-style file with coordinates for d4yjxa_.
(The format of our PDB-style files is described here.)

Timeline for d4yjxa_: