SCOPe 2.08: Domain d4yb5d1: 4yb5 D:5-224

Lineage for d4yb5d1 (4yb5 D:5-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries)

8. Domain d4yb5d1: 4yb5 D:5-224 [312032]
   Other proteins in same PDB: d4yb5a2, d4yb5b2, d4yb5c2, d4yb5d2, d4yb5e2, d4yb5f2
   automated match to d1h3da1
   complexed with his, k, peg, pge, scn

Details for d4yb5d1

PDB Entry: 4yb5, 2.24 Å

PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the allosteric inhibitor histidine

PDB Compounds: (D:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d4yb5d1:

Sequence, based on SEQRES records:

>d4yb5d1 c.94.1.0 (D:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqar

Sequence, based on observed residues (ATOM records):

>d4yb5d1 c.94.1.0 (D:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqeqnlkdfeglri
atsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlkevkv
iyesracliqkenalskekqalvdkimlrvagvmqar

Timeline for d4yb5d1:

• d4yb5d1 first appeared in SCOPe 2.06
  
• d4yb5d1 appears in SCOPe 2.07