Lineage for d4y0wb1 (4y0w B:1-108)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885484Species Pseudomonas aeruginosa [TaxId:1191475] [311877] (1 PDB entry)
  8. 2885487Domain d4y0wb1: 4y0w B:1-108 [311939]
    automated match to d4yduc1
    complexed with na

Details for d4y0wb1

PDB Entry: 4y0w (more details), 2.5 Å

PDB Description: yeaz from pseudomonas aeruginosa
PDB Compounds: (B:) YeaZ

SCOPe Domain Sequences for d4y0wb1:

Sequence, based on SEQRES records: (download)

>d4y0wb1 c.55.1.0 (B:1-108) automated matches {Pseudomonas aeruginosa [TaxId: 1191475]}
mstllaldtsteacsvallhegralshyeviprlhaqrllpmvrdlldeagvalsavdai
afgrgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg

Sequence, based on observed residues (ATOM records): (download)

>d4y0wb1 c.55.1.0 (B:1-108) automated matches {Pseudomonas aeruginosa [TaxId: 1191475]}
mstllaldtsteacsvallhegralshyevilhaqrllpmvrdlldeagvalsavdaiaf
grgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg

SCOPe Domain Coordinates for d4y0wb1:

Click to download the PDB-style file with coordinates for d4y0wb1.
(The format of our PDB-style files is described here.)

Timeline for d4y0wb1: