Lineage for d4xria_ (4xri A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333294Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2333295Protein automated matches [190220] (14 species)
    not a true protein
  7. 2333319Species Chaetomium thermophilum [TaxId:759272] [311934] (1 PDB entry)
  8. 2333320Domain d4xria_: 4xri A: [311935]
    automated match to d3nd2a_
    complexed with gol, so4

Details for d4xria_

PDB Entry: 4xri (more details), 2.05 Å

PDB Description: crystal structure of importin beta in an ammonium sulfate condition
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4xria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xria_ a.118.1.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
pdiniilenslspdatlrhaaeqqlthaaetnfsqylltlvqalanesseghiraaagia
lknafsarefarqaalqakwlnqtdqetrtrvkqlaletlaspnskagqaaaqviaaiaa
ielprnqwpelmhalvrnaseggqhqkqasltaigficetqdtdlrnslvghsnailtav
vqgarkeepnnevrfaaitalgdslefvgnnfkhegernyimqvvceatqaqdsriqqga
fgclnrimalyyehmryymekalfgltilgmksddedvaklavefwstvceeeiaieddn
aqvesseqmrpfynfarvatnevvpvllqlltkqdedasddeynisraayqclqlyaqav
gstiippviqfvehnlrhadwhfrdaavsafgaimdgpeekvlepivktgmqpliammed
esiqvrdstayalgriteacseaidpnthleplirslfnglmnspkmaasccwalmniae
rfagepgaaqnpltphfnqsvtnlltvtapmngdstvrtaayevlsvfvqnaandslsav
aslstvilqrleetlplqqqvvsvedkliledmqtslctvlqatvqrldkeiapqgdrim
qvllqilstcggkssvpegvfaaisalanameeefakymeafapflynalgnqeepslcs
maiglvsdvtrslgersqpycdnfmnyllgnlrsttlanqfkpailqcfgdiasaigghf
etyltivaqvlqqaatitagpdgsyemidyvislregimdawggiigamktsnktnvlqp
yvesifallnsiandpnrsealmrasmgvigdladaypngqladafrqdwitamiretrs
nrefgartietarwareqvkrqiag

SCOPe Domain Coordinates for d4xria_:

Click to download the PDB-style file with coordinates for d4xria_.
(The format of our PDB-style files is described here.)

Timeline for d4xria_: