Lineage for d4y4ca_ (4y4c A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2069061Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2069715Protein Endothiapepsin [50647] (1 species)
  7. 2069716Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (507 PDB entries)
  8. 2069891Domain d4y4ca_: 4y4c A: [311900]
    automated match to d1oewa_
    complexed with 47k, act, gol

Details for d4y4ca_

PDB Entry: 4y4c (more details), 1.24 Å

PDB Description: endothiapepsin in complex with fragment 158
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d4y4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y4ca_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d4y4ca_:

Click to download the PDB-style file with coordinates for d4y4ca_.
(The format of our PDB-style files is described here.)

Timeline for d4y4ca_:

  • d4y4ca_ appears in periodic updates to SCOPe 2.06 starting on 2016-04-12
  • d4y4ca_ became obsolete in SCOPe 2.07