SCOPe 2.06: Domain d4y2za_: 4y2z A:

Lineage for d4y2za_ (4y2z A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (10 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [311867] (10 PDB entries)

8. Domain d4y2za_: 4y2z A: [311879]
   automated match to d2lgja_
   mutant

Details for d4y2za_

PDB Entry: 4y2z, 2.43 Å

PDB Description: crystal structure of peptidyl-trna hydrolase mutant -h24n from vibrio cholerae

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4y2za_:

Sequence; same for both SEQRES and ATOM records:

>d4y2za_ c.56.3.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
vsqpikllvglanpgpeyaktrnnagawvveelarihnvtlknepkffgltgrllinsqe
lrvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglk
dtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilmk
dgltkaqnrlhtfkae

Timeline for d4y2za_:

• d4y2za_ is new in SCOPe 2.06-stable
  
• d4y2za_ does not appear in SCOPe 2.07