SCOPe 2.06: Domain d4s35b_: 4s35 B:

Lineage for d4s35b_ (4s35 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188217] (15 PDB entries)

8. Domain d4s35b_: 4s35 B: [311852]
   automated match to d2pbra_
   complexed with acp, cl, edo, mg, tmp

Details for d4s35b_

PDB Entry: 4s35, 1.55 Å

PDB Description: amppcp and tmp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4s35b_:

Sequence; same for both SEQRES and ATOM records:

>d4s35b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgvlr

Timeline for d4s35b_:

• d4s35b_ is new in SCOPe 2.06-stable
  
• d4s35b_ appears in SCOPe 2.07
  
• d4s35b_ appears in the current release, SCOPe 2.08