Lineage for d1ag9b_ (1ag9 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein Flavodoxin [52220] (11 species) 
Species Escherichia coli [TaxId:562] [52224] (2 PDB entries) 
Domain d1ag9b_: 1ag9 B: [31179]
complexed with btb, ca, cl, fmn, na
Details for d1ag9b_
PDB Entry: 1ag9 (more details), 1.8 Å
PDB Description: flavodoxins that are required for enzyme activation: the structure of oxidized flavodoxin from escherichia coli at 1.8 angstroms resolution.
PDB Compounds: (B:) flavodoxinSCOPe Domain Sequences for d1ag9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ag9b_ c.23.5.1 (B:) Flavodoxin {Escherichia coli [TaxId: 562]}
aitgiffgsdtgnteniakmiqkqlgkdvadvhdiaksskedleaydilllgiptwyyge
aqcdwddffptleeidfngklvalfgcgdqedyaeyfcdalgtirdiieprgativghwp
tagyhfeaskgladddhfvglaidedrqpeltaervekwvkqiseelhldeilna
SCOPe Domain Coordinates for d1ag9b_:
Click to download the PDB-style file with coordinates for d1ag9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ag9b_:
- d1ag9b_ first appeared (with stable ids) in SCOP 1.55
- d1ag9b_ appears in SCOPe 2.07
View in 3D
