Lineage for d1qhea_ (1qhe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856359Protein Flavodoxin [52220] (11 species)
  7. 2856360Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 2856364Domain d1qhea_: 1qhe A: [31177]
    complexed with so4

Details for d1qhea_

PDB Entry: 1qhe (more details), 2 Å

PDB Description: energetics of a hydrogen bond (charged and neutral) and of a cation-pi interaction in apoflavodoxin
PDB Compounds: (A:) protein (flavodoxin)

SCOPe Domain Sequences for d1qhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhea_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d1qhea_:

Click to download the PDB-style file with coordinates for d1qhea_.
(The format of our PDB-style files is described here.)

Timeline for d1qhea_: