Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (7 families) |
Family c.23.5.1: Flavodoxin-related [52219] (4 proteins) binds FMN |
Protein Flavodoxin [52220] (7 species) |
Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries) |
Domain d1ftg__: 1ftg - [31176] apo form |
PDB Entry: 1ftg (more details), 2 Å
SCOP Domain Sequences for d1ftg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftg__ c.23.5.1 (-) Flavodoxin {Anabaena, pcc 7119 and 7120} kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
Timeline for d1ftg__: