Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries) |
Domain d4wrfa2: 4wrf A:110-228 [311748] Other proteins in same PDB: d4wrfa1 automated match to d3pbfa2 complexed with ca, cl, hez, man; mutant |
PDB Entry: 4wrf (more details), 1.9 Å
SCOPe Domain Sequences for d4wrfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wrfa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]} smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm iddqtegdfhyldgasvsytnwypgepngqgkedcvemytdgtwndrgclqyrlavcef
Timeline for d4wrfa2: