Lineage for d1dx9c_ (1dx9 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481332Superfamily c.23.5: Flavoproteins [52218] (7 families) (S)
  5. 481333Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
    binds FMN
  6. 481334Protein Flavodoxin [52220] (7 species)
  7. 481335Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)
  8. 481341Domain d1dx9c_: 1dx9 C: [31173]

Details for d1dx9c_

PDB Entry: 1dx9 (more details), 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena

SCOP Domain Sequences for d1dx9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx9c_ c.23.5.1 (C:) Flavodoxin {Anabaena, pcc 7119 and 7120}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1dx9c_:

Click to download the PDB-style file with coordinates for d1dx9c_.
(The format of our PDB-style files is described here.)

Timeline for d1dx9c_: