SCOPe 2.06: Domain d4s1oa_: 4s1o A:

Lineage for d4s1oa_ (4s1o A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [269137] (4 PDB entries)

8. Domain d4s1oa_: 4s1o A: [311704]
   automated match to d1yula_
   complexed with cl, nap

Details for d4s1oa_

PDB Entry: 4s1o, 1.84 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with nadp

PDB Compounds: (A:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4s1oa_:

Sequence, based on SEQRES records:

>d4s1oa_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records):

>d4s1oa_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviatasnp
rfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweelfelarf
vgvsrpgydaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt

Timeline for d4s1oa_:

• d4s1oa_ is new in SCOPe 2.06-stable
  
• d4s1oa_ appears in SCOPe 2.07
  
• d4s1oa_ appears in the current release, SCOPe 2.08