SCOP 1.69: Domain d1rcf__: 1rcf -

Lineage for d1rcf__ (1rcf -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (7 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (7 species)

7. Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (7 PDB entries)

8. Domain d1rcf__: 1rcf - [31170]

Details for d1rcf__

PDB Entry: 1rcf, 1.4 Å

PDB Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution

SCOP Domain Sequences for d1rcf__:

Sequence; same for both SEQRES and ATOM records:

>d1rcf__ c.23.5.1 (-) Flavodoxin {Anabaena, pcc 7119 and 7120}
skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d1rcf__:

• d1rcf__ first appeared (with stable ids) in SCOP 1.55
  
• d1rcf__ appears in SCOP 1.67
  
• d1rcf__ appears in SCOP 1.71
  
• d1rcf__ appears in the current release, SCOPe 2.08, called d1rcfa_