SCOPe 2.06: Domain d4xr5b2: 4xr5 B:71-335

Lineage for d4xr5b2 (4xr5 B:71-335)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families)
   automatically mapped to Pfam PF00591

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)

6. Protein automated matches [254642] (3 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [311684] (2 PDB entries)

8. Domain d4xr5b2: 4xr5 B:71-335 [311685]
   Other proteins in same PDB: d4xr5a1, d4xr5a3, d4xr5b1, d4xr5b3
   automated match to d4x46b2
   complexed with cl, peg, pge

Details for d4xr5b2

PDB Entry: 4xr5, 2.05 Å

PDB Description: x-ray structure of the unliganded thymidine phosphorylase from salmonella typhimurium at 2.05 a resolution

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4xr5b2:

Sequence; same for both SEQRES and ATOM records:

>d4xr5b2 c.27.1.1 (B:71-335) automated matches {Salmonella enterica [TaxId: 90371]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

Timeline for d4xr5b2:

• d4xr5b2 is new in SCOPe 2.06-stable
  
• d4xr5b2 appears in SCOPe 2.07
  
• d4xr5b2 appears in the current release, SCOPe 2.08