Lineage for d4x57a1 (4x57 A:1-147)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508195Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311631] (1 PDB entry)
  8. 2508196Domain d4x57a1: 4x57 A:1-147 [311677]
    Other proteins in same PDB: d4x57a2, d4x57b_, d4x57c2, d4x57d_
    automated match to d2c2vb_
    complexed with so4

Details for d4x57a1

PDB Entry: 4x57 (more details), 2.8 Å

PDB Description: structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 8

SCOPe Domain Sequences for d4x57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x57a1 d.20.1.0 (A:1-147) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
maskrilkelkdlqkdpptscsagpvaedmfhwqatimgpaespysggvflvtihfppdy
pfkppkvafrtkvfhpninsngsicldilkeqwspaltiskvllsicslltdpnpddplv
peiahmyktdrakyeatarnwtqkyam

SCOPe Domain Coordinates for d4x57a1:

Click to download the PDB-style file with coordinates for d4x57a1.
(The format of our PDB-style files is described here.)

Timeline for d4x57a1: