SCOPe 2.08: Domain d4d65f_: 4d65 F:

Lineage for d4d65f_ (4d65 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.0: automated matches [267625] (1 protein)
   not a true family

6. Protein automated matches [267676] (11 species)
   not a true protein

7. Species Providencia stuartii [TaxId:588] [311523] (4 PDB entries)

8. Domain d4d65f_: 4d65 F: [311645]
   automated match to d2j1na_
   complexed with ftt, lda, myr, so4

Details for d4d65f_

PDB Entry: 4d65, 2.2 Å

PDB Description: structure of porin omp-pst2 from p. stuartii; the asymmetric unit contains a dimer of trimers.

PDB Compounds: (F:) porin 2

SCOPe Domain Sequences for d4d65f_:

Sequence; same for both SEQRES and ATOM records:

>d4d65f_ f.4.3.0 (F:) automated matches {Providencia stuartii [TaxId: 588]}
aevynkdgnkldvygqidvrhyfadaksgedgddsrvrlgfkgdtqitdqligfgrfewe
tstnkaetsndnqnrlayaglkfadygsldygrnygviydtnawtdvlplwgadtmdqed
tfmmgrnrnlltyrnnngfgyidglsfalqyqgkngdqnkstgssaldnngdgygfstay
elgwglsigggysnssrtpsqnniktgatgkraeawnvgskleldelylaamygqtlntt
rfgdddaeaianktenlelvalysfdfgltpsigynqskgknlgnygnkdlvkyiavgas
ydfnknmaavidykinllkdnqftddygintdnvlglgliyqf

Timeline for d4d65f_:

• d4d65f_ first appeared in SCOPe 2.06
  
• d4d65f_ appears in SCOPe 2.07