Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Daphnia pulex [TaxId:6669] [311638] (12 PDB entries) |
Domain d4xnnb_: 4xnn B: [311639] automated match to d4csib_ complexed with gol |
PDB Entry: 4xnn (more details), 1.9 Å
SCOPe Domain Sequences for d4xnnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xnnb_ b.29.1.0 (B:) automated matches {Daphnia pulex [TaxId: 6669]} envgtqaaeeplnlpisvctapgncqteadavvldsnwrwahtttgytncytgnlwdttl cptpetcttncaidgvpladwsgtyggsvtgnkfnlkfvtvgpystnigartflldstkt ryrmfqllnreftydvdvssldcglngalyfvsmdadggaakyptnkggakygtgycdaq cphdvkwinglanskdwtpipgdansgkgyygnccaeldiweankqsqaftthpctpndq trcegvvcgdndsgdryngmcdkdgcdfasyrmndhtfygpgstfkldstkpftvvsqfi ttdgtdngdfkefrrfyvqngvrienskvnfpgitaydsitdemcaatkglfgdlddhkn kggmkqmgeamrkgmalvmsiwddhdvnmlwldsnypptgnpstpgvargpcpttsgvps evevtqanavvsfgnikfgpigstv
Timeline for d4xnnb_: