![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.0: automated matches [227226] (1 protein) not a true family |
![]() | Protein automated matches [226967] (6 species) not a true protein |
![]() | Species Mannheimia haemolytica [TaxId:75985] [311626] (1 PDB entry) |
![]() | Domain d4d5fa2: 4d5f A:68-206 [311627] Other proteins in same PDB: d4d5fa1 automated match to d2vpra2 complexed with cl, gol, so4 |
PDB Entry: 4d5f (more details), 2.2 Å
SCOPe Domain Sequences for d4d5fa2:
Sequence, based on SEQRES records: (download)
>d4d5fa2 a.121.1.0 (A:68-206) automated matches {Mannheimia haemolytica [TaxId: 75985]} lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl sqavyalssiahftlgsvletqehqesqkerekvetdtvaypplltqavaimdsdngdaa flfvldvmisgletvlksa
>d4d5fa2 a.121.1.0 (A:68-206) automated matches {Mannheimia haemolytica [TaxId: 75985]} lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl sqavyalssiahftlgsvletqehqesqkeaypplltqavaimdsdngdaaflfvldvmi sgletvlksa
Timeline for d4d5fa2: