Lineage for d4v37d_ (4v37 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482871Species Spinach (Spinacia oleracea) [TaxId:3562] [195640] (4 PDB entries)
  8. 2482887Domain d4v37d_: 4v37 D: [311618]
    automated match to d4a0ma_
    complexed with 0d8, ae3, fmt, k, nad, pg4

Details for d4v37d_

PDB Entry: 4v37 (more details), 2.1 Å

PDB Description: crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3- aminopropionaldehyde
PDB Compounds: (D:) betaine aldehyde dehydrogenase, chloroplastic

SCOPe Domain Sequences for d4v37d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v37d_ c.82.1.0 (D:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
piparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnnw
satsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqae
aldgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlkp
selasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgskv
masaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqiasatsrllvhesi
aaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsrp
ehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaavf
sndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqvt
qdisdepwgwyks

SCOPe Domain Coordinates for d4v37d_:

Click to download the PDB-style file with coordinates for d4v37d_.
(The format of our PDB-style files is described here.)

Timeline for d4v37d_: