SCOPe 2.07: Domain d4x09a_: 4x09 A:

Lineage for d4x09a_ (4x09 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)

8. Domain d4x09a_: 4x09 A: [311606]
   automated match to d5e13a_
   complexed with gol, so4

Details for d4x09a_

PDB Entry: 4x09, 1.72 Å

PDB Description: structure of human rnase 6 in complex with sulphate anions

PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d4x09a_:

Sequence; same for both SEQRES and ATOM records:

>d4x09a_ d.5.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
pvhldsil

Timeline for d4x09a_:

• d4x09a_ first appeared in SCOPe 2.06
  
• d4x09a_ appears in the current release, SCOPe 2.08, called d4x09a1