Lineage for d4x57b_ (4x57 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502892Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [311557] (1 PDB entry)
  8. 2502893Domain d4x57b_: 4x57 B: [311600]
    Other proteins in same PDB: d4x57a1, d4x57a2, d4x57c1, d4x57c2
    automated match to d1se9a_
    complexed with so4

Details for d4x57b_

PDB Entry: 4x57 (more details), 2.8 Å

PDB Description: structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex
PDB Compounds: (B:) Membrane-anchored ubiquitin-fold protein 3

SCOPe Domain Sequences for d4x57b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x57b_ d.15.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
peeesidikfrlydgsdigpfrysaastvdflkqrvvsdwpkgktvvpkginevklissg
kilennktvgqcktpfgdiaggvivmhvvvqps

SCOPe Domain Coordinates for d4x57b_:

Click to download the PDB-style file with coordinates for d4x57b_.
(The format of our PDB-style files is described here.)

Timeline for d4x57b_: