Lineage for d2n8ra_ (2n8r A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205733Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2205734Species Human (Homo sapiens) [TaxId:9606] [69781] (39 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2205788Domain d2n8ra_: 2n8r A: [311564]
    automated match to d2k2ga_
    complexed with ca, zn

Details for d2n8ra_

PDB Entry: 2n8r (more details)

PDB Description: productive complex between mmp-12 and synthetic triple-helical collagen, revealed through paramagnetic nmr
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2n8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n8ra_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhe
ighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d2n8ra_:

Click to download the PDB-style file with coordinates for d2n8ra_.
(The format of our PDB-style files is described here.)

Timeline for d2n8ra_: