Lineage for d4v3fa_ (4v3f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141644Species Spinach (Spinacia oleracea) [TaxId:3562] [195640] (4 PDB entries)
  8. 2268254Domain d4v3fa_: 4v3f A: [311560]
    automated match to d4a0ma_
    complexed with cht, etx, gol, iod, pg4

Details for d4v3fa_

PDB Entry: 4v3f (more details), 1.98 Å

PDB Description: crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with betaine aldehyde
PDB Compounds: (A:) betaine aldehyde dehydrogenase, chloroplastic

SCOPe Domain Sequences for d4v3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v3fa_ c.82.1.0 (A:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]}
fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn
wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa
ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk
pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk
vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes
iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr
pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav
fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv
tqdisdepwgwyksp

SCOPe Domain Coordinates for d4v3fa_:

Click to download the PDB-style file with coordinates for d4v3fa_.
(The format of our PDB-style files is described here.)

Timeline for d4v3fa_:

  • d4v3fa_ appears in periodic updates to SCOPe 2.06 starting on 2016-04-12