SCOPe 2.08: Domain d4uefa_: 4uef A:

Lineage for d4uefa_ (4uef A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188484] (6 PDB entries)

8. Domain d4uefa_: 4uef A: [311544]
   automated match to d2v77a_
   complexed with tje, zn

Details for d4uefa_

PDB Entry: 4uef, 1.69 Å

PDB Description: crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-tyr-ala-y(po2ch2)-homophe-oh

PDB Compounds: (A:) Carboxypeptidase A1

SCOPe Domain Sequences for d4uefa_:

Sequence; same for both SEQRES and ATOM records:

>d4uefa_ c.56.5.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpai
widtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafthst
nrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivdf
vkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnygs
iikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltime
htlnhp

Timeline for d4uefa_:

• d4uefa_ first appeared in SCOPe 2.06
  
• d4uefa_ appears in SCOPe 2.07