SCOPe 2.06: Domain d4d5ca2: 4d5c A:68-205

Lineage for d4d5ca2 (4d5c A:68-205)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.0: automated matches [227226] (1 protein)
   not a true family

6. Protein automated matches [226967] (5 species)
   not a true protein

7. Species Proteus mirabilis [TaxId:584] [311529] (1 PDB entry)

8. Domain d4d5ca2: 4d5c A:68-205 [311530]
   Other proteins in same PDB: d4d5ca1
   automated match to d2vpra2
   complexed with so4

Details for d4d5ca2

PDB Entry: 4d5c, 1.7 Å

PDB Description: tetracycline repressor class j, apo form

PDB Compounds: (A:) tetracycline repressor protein tetr

SCOPe Domain Sequences for d4d5ca2:

Sequence, based on SEQRES records:

>d4d5ca2 a.121.1.0 (A:68-205) automated matches {Proteus mirabilis [TaxId: 584]}
lplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflcdagftl
tqavyalssiahftlgsvletqehqesqkerekvpkteinypplltqaidimdsdngeaa
flfvldvmisgletvlnn

Sequence, based on observed residues (ATOM records):

>d4d5ca2 a.121.1.0 (A:68-205) automated matches {Proteus mirabilis [TaxId: 584]}
lplaneswqdflrnnaksfrqallmyrdggkihagtrpsanqfetseqqlqflcdagftl
tqavyalssiahftlgsvletqehqesqinypplltqaidimdsdngeaaflfvldvmis
gletvlnn

Timeline for d4d5ca2:

• d4d5ca2 is new in SCOPe 2.06-stable
  
• d4d5ca2 appears in SCOPe 2.07
  
• d4d5ca2 appears in the current release, SCOPe 2.08