SCOP 1.71: Domain d1cqjb1: 1cqj B:239-385

Lineage for d1cqjb1 (1cqj B:239-385)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
Domain d1cqjb1: 1cqj B:239-385 [31143]
Other proteins in same PDB: d1cqja1, d1cqja2, d1cqjb2, d1cqjd1, d1cqjd2, d1cqje2

Details for d1cqjb1

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqjb1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d1cqjb1:

Click to download the PDB-style file with coordinates for d1cqjb1.
(The format of our PDB-style files is described here.)

Timeline for d1cqjb1: