Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species) |
Species Escherichia coli [TaxId:562] [52216] (6 PDB entries) |
Domain d2scub1: 2scu B:239-385 [31141] Other proteins in same PDB: d2scua1, d2scua2, d2scub2, d2scud1, d2scud2, d2scue2 |
PDB Entry: 2scu (more details), 2.3 Å
SCOP Domain Sequences for d2scub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2scub1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga kkladsglniiaakgltdaaqqvvaav
Timeline for d2scub1: