Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries) |
Domain d1euca2: 1euc A:131-306 [31139] Other proteins in same PDB: d1euca1, d1eucb1, d1eucb2, d1eucb3 complexed with po4, so4, zn |
PDB Entry: 1euc (more details), 2.1 Å
SCOPe Domain Sequences for d1euca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euca2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml
Timeline for d1euca2: